PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_F013240B3.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 153aa    MW: 17642.4 Da    PI: 10.9962
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_F013240B3.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.71.2e-131570560
                           CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60
                           kr rr   NR++A +s +RK ++i eLe kv++L++e + L  ++++ kk  a+l 
  Traes_5AL_F013240B3.1 15 KRVRRILNNRLSAAKSKERKAKYIVELEGKVQVLQGETMNLSAQVKMVKKGQARLS 70
                           899**********************************************9888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.9E-101175IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.5991364IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.2E-111569No hitNo description
PfamPF001706.1E-111569IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.88E-111569No hitNo description
CDDcd147032.67E-131667No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MDSEHLAQIV LTDPKRVRRI LNNRLSAAKS KERKAKYIVE LEGKVQVLQG ETMNLSAQVK  60
MVKKGQARLS IHNHEMRIRL QALEEQAQLK KALNEALHAE VERLNLVVAE ASNPHMPNSS  120
EQRMSSQMIQ LHQLQILRQP SQLQQGQQRQ RNF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576738.19e-41PREDICTED: transcription factor RF2a-like isoform X1
SwissprotQ6S4P45e-34RF2B_ORYSJ; Transcription factor RF2b
TrEMBLW5F2T91e-105W5F2T9_WHEAT; Uncharacterized protein
TrEMBLM8A4J11e-104M8A4J1_TRIUA; Transcription factor RF2b
STRINGMLOC_51623.14e-77(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP148701820
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-35bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]